PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000253189
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 217aa    MW: 24296.1 Da    PI: 9.4241
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000253189genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.63.4e-30129187159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +dDg++WrKYG+K+vk+s++pr+YY+C+  gC+vkk+ver+++d ++v++tYeg Hnhe
  MDP0000253189 129 MDDGFKWRKYGKKSVKNSPNPRNYYKCSNGGCNVKKRVERDRDDASYVITTYEGVHNHE 187
                    59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-32116189IPR003657WRKY domain
SuperFamilySSF1182901.27E-27122189IPR003657WRKY domain
PROSITE profilePS5081130.699124189IPR003657WRKY domain
SMARTSM007741.1E-34129188IPR003657WRKY domain
PfamPF031067.1E-24130187IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MGAMGAALSS IRVRVAIRPL APPWWPTALG EKYIVDPPPM DFDELSNYLM LDEYDFSRDH  60
QDSSSSQSVG SSSQNFAGGA GSGGSSGEIR LITICKYRRN VEVRRNKLNK VEGGNHRVAF  120
RTKSELEVMD DGFKWRKYGK KSVKNSPNPR NYYKCSNGGC NVKKRVERDR DDASYVITTY  180
EGVHNHESPS VVYYNQMHAD PNNIWTLRAS SQSSASS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-24117189274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008342835.11e-97PREDICTED: probable WRKY transcription factor 51 isoform X1
SwissprotQ93WU97e-47WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLM5W2474e-70M5W247_PRUPE; Uncharacterized protein
STRINGPOPTR_0007s06720.11e-54(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112034110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.15e-45WRKY DNA-binding protein 51